PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn005711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 276aa    MW: 31327 Da    PI: 4.8086
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn005711genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-173175147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
       Achn005711 31 RGRFTPEEEKLIISLHGAVGNR-WAHIASHLP-GRTDNEIKNYWNSW 75
                     89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.623125IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.1E-111137IPR009057Homeodomain-like
SuperFamilySSF466896.27E-221182IPR009057Homeodomain-like
PROSITE profilePS5129425.5112680IPR017930Myb domain
SMARTSM007171.2E-163078IPR001005SANT/Myb domain
PfamPF002498.9E-163175IPR001005SANT/Myb domain
CDDcd001672.68E-123376No hitNo description
Gene3DG3DSA:1.10.10.604.3E-213876IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MASRTISSGL QRCGKSCRLR WINYLRPDIR RGRFTPEEEK LIISLHGAVG NRWAHIASHL  60
PGRTDNEIKN YWNSWIKKKI RKPTPPPPAT NKPSTNDQHS QLNNYVSNQV DNFLNNNQDL  120
LTKPPLQDTL FSSPTPLFMF DTSGSLEGII ADGNQRRELF HEPEGLNSET WHMNQQDVQE  180
LNPTASFSMD SNYLPSLINL EIEVPMDHQV QCCGVNEERD MGLDCLEREE LMNVEWVESQ  240
QCSSFLFWDQ SEGPLCGDEI APASSNMGTM LSSYP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-21128040108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273004.11e-120PREDICTED: transcription factor MYB86
TrEMBLD7TV591e-120D7TV59_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g00320.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA124391722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.12e-54myb domain protein 103